PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G287200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 190aa    MW: 21624.1 Da    PI: 6.8037
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G287200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28e-181562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT eEd++l+++++ +G g W++ ar  g++Rt+k+c++rw++yl
  Aqcoe3G287200.1.p 15 KGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL 62
                       79********************************************97 PP

2Myb_DNA-binding54.33.2e-1768111146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg+ T+eE++l+ ++++++G++ W++Iar+++ gRt++++k++w++
  Aqcoe3G287200.1.p  68 RGNITPEEQLLIMELHARWGNR-WSKIARHLP-GRTDNEIKNFWRT 111
                        7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-23865IPR009057Homeodomain-like
PROSITE profilePS5129414.4931062IPR017930Myb domain
SuperFamilySSF466895.39E-3013109IPR009057Homeodomain-like
SMARTSM007171.0E-121464IPR001005SANT/Myb domain
PfamPF002492.7E-161562IPR001005SANT/Myb domain
CDDcd001674.33E-101762No hitNo description
PROSITE profilePS5129424.14963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-2466117IPR009057Homeodomain-like
SMARTSM007171.5E-1467115IPR001005SANT/Myb domain
PfamPF002491.4E-1568111IPR001005SANT/Myb domain
CDDcd001672.68E-1172111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MDKKPSSSEE GEVRKGPWTM EEDLILINYI ANHGEGVWNS LARSAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQLLIM ELHARWGNRW SKIARHLPGR TDNEIKNFWR TKIQKHIKQP  120
ENGAGPSSER NDSASSSHVS GAEEGAENYS SMYTGNMEAF PTPPPAAEPN EHFWSMEDFW  180
SMQLLNSDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341440.11e-100PREDICTED: myb-related protein 305-like
SwissprotP813912e-94MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A068U0Q21e-104A0A068U0Q2_COFCA; Uncharacterized protein
STRINGVIT_14s0066g01090.t011e-98(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.13e-80myb domain protein 21